MMP1 Antikörper

Produktnummer ABIN630128

Produktdetails anti-MMP1 Antikörper

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP1 Blocking Peptide, catalog no. 33R-6984, is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP1

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Andere Bezeichnung: MMP1 (MMP1 Produkte)

Synonyme: CLG antikoerper, CLGN antikoerper, Mmp1a antikoerper, CG4859 antikoerper, Dm1-MMP antikoerper, Dmel\\CG4859 antikoerper, MMP-1 antikoerper, MMP1 antikoerper, Mmp 1 antikoerper, dMMP1 antikoerper, dm1-MMP antikoerper, dmmp1 antikoerper, l(2)k04809 antikoerper, mmp1 antikoerper, Mmp1 antikoerper, Mcol-A antikoerper, Mcola antikoerper, col4 antikoerper, mmp18 antikoerper, Clgn antikoerper, matrix metallopeptidase 1 antikoerper, Matrix metalloproteinase 1 antikoerper, matrix metalloproteinase 1 antikoerper, matrix metallopeptidase 1 (interstitial collagenase) antikoerper, matrix metallopeptidase 1a (interstitial collagenase) antikoerper, matrix metallopeptidase 1 S homeolog antikoerper, interstitial collagenase antikoerper, matrix metallopeptidase 8 L homeolog antikoerper, MMP1 antikoerper, Mmp1 antikoerper, RB11133 antikoerper, Mmp1a antikoerper, mmp1.S antikoerper, LOC100727966 antikoerper, mmp8.L antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Molekulargewicht: 52 kDa (MW of target protein)