FGA Antikörper (N-Term)

Produktnummer ABIN630126

Zitiert in 1 Publikation. Der Kaninchen Polyklonal anti-FGA Antikörper (ABIN630126) detektiert spezifisch FGA in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FGA Antikörper (N-Term) (ABIN630126)

Target: FGA (Fibrinogen alpha Chain (FGA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FGA Antikörper

Bindungsspezifität: N-Term

Spezifität: Fibrinogen Alpha antibody was raised against the N terminal of FGA

Aufreinigung: Purified

Immunogen: Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Fibrinogen Alpha Blocking Peptide, (ABIN5613586), is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-FGA Antikörper (ABIN630126)

Matsumoto, Matsuura, Aoki, Maehashi, Iwamoto, Ohkawa, Yoshida, Yanaga, Takada: "An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line." in: Hepatology research : the official journal of the Japan Society of Hepatology, Vol. 45, Issue 3, pp. 315-25, (2016) (PubMed).

Details zu FGA

Target: FGA (Fibrinogen alpha Chain (FGA))

Andere Bezeichnung: Fibrinogen alpha

Hintergrund: FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.

Molekulargewicht: 71 kDa (MW of target protein)