MBNL1 Antikörper
-
- Target Alle MBNL1 Antikörper anzeigen
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBNL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA
- Top Product
- Discover our top product MBNL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MBNL1 Blocking Peptide, catalog no. 33R-4829, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
- Andere Bezeichnung
- MBNL1 (MBNL1 Produkte)
- Synonyme
- MBNL1 antikoerper, zgc:153954 antikoerper, Mbnl antikoerper, mKIAA0428 antikoerper, EXP antikoerper, EXP35 antikoerper, EXP40 antikoerper, EXP42 antikoerper, MBNL antikoerper, muscleblind like splicing regulator 1 antikoerper, muscleblind-like splicing regulator 1 antikoerper, muscleblind like splicing factor 1 antikoerper, MBNL1 antikoerper, mbnl1 antikoerper, Mbnl1 antikoerper
- Hintergrund
- MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-