MBNL1 Antikörper

Produktnummer ABIN630124

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MBNL1 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für MBNL1 Antikörper (ABIN630124)

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBNL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBNL1 Antikörper

Aufreinigung: Purified

Immunogen: MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBNL1 Blocking Peptide, (ABIN940215), is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBNL1

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Andere Bezeichnung: MBNL1

Hintergrund: MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization