RED1 Antikörper

Produktnummer ABIN630123

Produktdetails anti-RED1 Antikörper

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADARB1 Blocking Peptide, catalog no. 33R-7645, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RED1

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Andere Bezeichnung: ADARB1 (ADARB1 Produkte)

Synonyme: ADARB1 antikoerper, RED1 antikoerper, ADAR2 antikoerper, DRABA2 antikoerper, DRADA2 antikoerper, 1700057H01Rik antikoerper, AW124433 antikoerper, AW558573 antikoerper, Adar2 antikoerper, BB220382 antikoerper, D10Bwg0447e antikoerper, Red1 antikoerper, adar2 antikoerper, adarb1 antikoerper, red1 antikoerper, adenosine deaminase, RNA specific B1 antikoerper, adenosine deaminase, RNA-specific, B1 antikoerper, adenosine deaminase, RNA-specific, B1 L homeolog antikoerper, adenosine deaminase, RNA-specific, B1a antikoerper, ADARB1 antikoerper, adarb1 antikoerper, adarb1.L antikoerper, Adarb1 antikoerper, adarb1a antikoerper

Hintergrund: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Molekulargewicht: 77 kDa (MW of target protein)