RED1 Antikörper

Produktnummer ABIN630123

Dieses Anti-RED1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RED1 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für RED1 Antikörper (ABIN630123)

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RED1 Antikörper

Aufreinigung: Purified

Immunogen: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADARB1 Blocking Peptide, (ABIN5611941), is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RED1

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Andere Bezeichnung: ADARB1

Hintergrund: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Molekulargewicht: 77 kDa (MW of target protein)