FABP7 Antikörper (N-Term)
-
- Target Alle FABP7 Antikörper anzeigen
- FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FABP7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FABP7 antibody was raised against the N terminal of FABP7
- Aufreinigung
- Purified
- Immunogen
- FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF
- Top Product
- Discover our top product FABP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FABP7 Blocking Peptide, catalog no. 33R-6680, is also available for use as a blocking control in assays to test for specificity of this FABP7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))
- Andere Bezeichnung
- FABP7 (FABP7 Produkte)
- Hintergrund
- The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
- Molekulargewicht
- 15 kDa (MW of target protein)
-