FABP7 Antikörper (N-Term)

Produktnummer ABIN630122

Der Kaninchen Polyklonal Anti-FABP7-Antikörper wurde für WB validiert. Er ist geeignet, FABP7 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für FABP7 Antikörper (N-Term) (ABIN630122)

Target: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FABP7 Antikörper

Bindungsspezifität: N-Term

Spezifität: FABP7 antibody was raised against the N terminal of FABP7

Aufreinigung: Purified

Immunogen: FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FABP7 Blocking Peptide, (ABIN5613448), is also available for use as a blocking control in assays to test for specificity of this FABP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FABP7

Target: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Andere Bezeichnung: FABP7

Hintergrund: The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.

Molekulargewicht: 15 kDa (MW of target protein)