KCNK13 Antikörper (C-Term)

Produktnummer ABIN630111

Dieses Anti-KCNK13-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KCNK13 in WB. Geeignet für Human.

Kurzübersicht für KCNK13 Antikörper (C-Term) (ABIN630111)

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNK13 Antikörper

Bindungsspezifität: C-Term

Spezifität: KCNK13 antibody was raised against the C terminal of KCNK13

Aufreinigung: Purified

Immunogen: KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK13 Blocking Peptide, (ABIN5614285), is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK13

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Andere Bezeichnung: KCNK13

Hintergrund: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of KCNK13 is an open channel that can be stimulated by arachidonic acid.

Molekulargewicht: 45 kDa (MW of target protein)