GABRA3 Antikörper
-
- Target Alle GABRA3 Antikörper anzeigen
- GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GABRA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
- Top Product
- Discover our top product GABRA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GABRA3 Blocking Peptide, catalog no. 33R-1156, is also available for use as a blocking control in assays to test for specificity of this GABRA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))
- Andere Bezeichnung
- GABRA3 (GABRA3 Produkte)
- Synonyme
- GABRA3 antikoerper, Gabra-3 antikoerper, si:ch211-113k9.1 antikoerper, gamma-aminobutyric acid type A receptor alpha3 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, alpha 3 antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3 antikoerper, gamma-aminobutyric acid receptor subunit alpha-3 antikoerper, GABRA3 antikoerper, gabra3 antikoerper, Gabra3 antikoerper, LOC100653496 antikoerper
- Hintergrund
- GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
- Molekulargewicht
- 55 kDa (MW of target protein)
-