CHRNB2 Antikörper

Produktnummer ABIN630100

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CHRNB2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CHRNB2 Antikörper (ABIN630100)

Target: CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHRNB2 Antikörper

Aufreinigung: Purified

Immunogen: CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNB2 Blocking Peptide, (ABIN939815), is also available for use as a blocking control in assays to test for specificity of this CHRNB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNB2

Target: CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))

Andere Bezeichnung: CHRNB2

Hintergrund: Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Feeding Behaviour