GRIK2 Antikörper (N-Term)

Produktnummer ABIN630095

Es gibt 1 Publikation für dieses Produkt. Der Kaninchen Polyklonal anti-GRIK2 Antikörper wird verwendet zum Nachweis von GRIK2 in Proben von Human, Maus, Ratte und Hund. Er wurde validiert für WB und IHC.

Kurzübersicht für GRIK2 Antikörper (N-Term) (ABIN630095)

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-GRIK2 Antikörper

Bindungsspezifität: N-Term

Spezifität: GRIK2 antibody was raised against the N terminal of GRIK2

Aufreinigung: Purified

Immunogen: GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIK2 Blocking Peptide, (ABIN5613864), is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-GRIK2 Antikörper (ABIN630095)

Kindt, Sheets: "Transmission Disrupted: Modeling Auditory Synaptopathy in Zebrafish." in: Frontiers in cell and developmental biology, Vol. 6, pp. 114, (2018) (PubMed).

Details zu GRIK2

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Andere Bezeichnung: GRIK2

Hintergrund: The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity