Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

KCTD18 Antikörper (N-Term)

KCTD18 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN630077
  • Target Alle KCTD18 Antikörper anzeigen
    KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))
    Bindungsspezifität
    • 5
    • 2
    • 1
    • 1
    • 1
    N-Term
    Reaktivität
    • 11
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Wirt
    • 9
    • 2
    Kaninchen
    Klonalität
    • 11
    Polyklonal
    Konjugat
    • 7
    • 2
    • 1
    • 1
    Dieser KCTD18 Antikörper ist unkonjugiert
    Applikation
    • 6
    • 5
    • 2
    • 1
    Western Blotting (WB)
    Spezifität
    KCTD18 antibody was raised against the N terminal of KCTD18
    Aufreinigung
    Purified
    Immunogen
    KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN
  • Applikationshinweise
    WB: 5 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    KCTD18 Blocking Peptide, catalog no. 33R-5035, is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))
    Andere Bezeichnung
    KCTD18 (KCTD18 Produkte)
    Synonyme
    KCTD18 antikoerper, 4932411A20Rik antikoerper, 6530404F10Rik antikoerper, RGD1564820 antikoerper, potassium channel tetramerization domain containing 18 antikoerper, potassium channel tetramerization domain containing 18 L homeolog antikoerper, potassium channel tetramerisation domain containing 18 antikoerper, KCTD18 antikoerper, kctd18.L antikoerper, Kctd18 antikoerper
    Hintergrund
    The function of Anti-KCTD18 has not yet been determined.
    Molekulargewicht
    47 kDa (MW of target protein)
Sie sind hier:
Kundenservice