KCTD10 Antikörper (N-Term)

Produktnummer ABIN630076

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KCTD10 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Hund.

Kurzübersicht für KCTD10 Antikörper (N-Term) (ABIN630076)

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCTD10 Antikörper

Bindungsspezifität: N-Term

Spezifität: KCTD10 antibody was raised against the N terminal of KCTD10

Aufreinigung: Purified

Immunogen: KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD10 Blocking Peptide, (ABIN5614301), is also available for use as a blocking control in assays to test for specificity of this KCTD10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD10

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Andere Bezeichnung: KCTD10

Hintergrund: KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.

Molekulargewicht: 34 kDa (MW of target protein)