Bestrophin 4 Antikörper (N-Term)

Produktnummer ABIN630067

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Bestrophin 4 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für Bestrophin 4 Antikörper (N-Term) (ABIN630067)

Target: Bestrophin 4 (BEST4)

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Bestrophin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Bestrophin 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: VMD2 L2 antibody was raised against the N terminal Of Vmd2 2

Aufreinigung: Purified

Immunogen: VMD2 L2 antibody was raised using the N terminal Of Vmd2 2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VMD2L2 Blocking Peptide, (ABIN5616970), is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VMD0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Bestrophin 4

Target: Bestrophin 4 (BEST4)

Andere Bezeichnung: VMD2L2

Hintergrund: VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.

Molekulargewicht: 52 kDa (MW of target protein)