CLIC1 Antikörper (C-Term)

Produktnummer ABIN630062

Der Kaninchen Polyklonal Anti-CLIC1-Antikörper wurde für WB validiert. Er ist geeignet, CLIC1 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für CLIC1 Antikörper (C-Term) (ABIN630062)

Target: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CLIC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: CLIC1 antibody was raised against the C terminal of CLIC1

Aufreinigung: Purified

Immunogen: CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC1

Target: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Andere Bezeichnung: CLIC1

Hintergrund: Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Molekulargewicht: 27 kDa (MW of target protein)