CLCN3 Antikörper (C-Term)

Produktnummer ABIN630057

Dieses Anti-CLCN3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CLCN3 in WB und IHC. Geeignet für Human.

Kurzübersicht für CLCN3 Antikörper (C-Term) (ABIN630057)

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CLCN3 Antikörper

Bindungsspezifität: C-Term

Spezifität: CLCN3 antibody was raised against the C terminal of CLCN3

Aufreinigung: Purified

Immunogen: CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCN3 Blocking Peptide, (ABIN5612915), is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCN3

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Andere Bezeichnung: CLCN3

Hintergrund: CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).

Molekulargewicht: 95 kDa (MW of target protein)