TMED4 Antikörper (N-Term)

Produktnummer ABIN630054

Der Kaninchen Polyklonal anti-TMED4 Antikörper (ABIN630054) detektiert spezifisch TMED4 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TMED4 Antikörper (N-Term) (ABIN630054)

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TMED4 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMED4 antibody was raised against the N terminal of TMED4

Aufreinigung: Purified

Immunogen: TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED4 Blocking Peptide, (ABIN5616652), is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED4

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Andere Bezeichnung: TMED4

Hintergrund: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Molekulargewicht: 25 kDa (MW of target protein)