APOO Antikörper (C-Term)

Produktnummer ABIN630052

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch APOO in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für APOO Antikörper (C-Term) (ABIN630052)

Target: APOO (Apolipoprotein O (APOO))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APOO Antikörper

Bindungsspezifität: C-Term

Spezifität: FAM121 B antibody was raised against the C terminal Of Fam121

Aufreinigung: Purified

Immunogen: FAM121 B antibody was raised using the C terminal Of Fam121 corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM121B Blocking Peptide, (ABIN5613464), is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOO

Target: APOO (Apolipoprotein O (APOO))

Andere Bezeichnung: FAM121B

Hintergrund: FAM121B belongs to the FAM121 family and the function remains unknown.

Molekulargewicht: 22 kDa (MW of target protein)