Splicing Factor 1 Antikörper (N-Term)
-
- Target Alle Splicing Factor 1 (SF1) Antikörper anzeigen
- Splicing Factor 1 (SF1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Splicing Factor 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SF1 antibody was raised against the N terminal of SF1
- Aufreinigung
- Purified
- Immunogen
- SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
- Top Product
- Discover our top product SF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF1 Blocking Peptide, catalog no. 33R-6645, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Splicing Factor 1 (SF1)
- Andere Bezeichnung
- SF1 (SF1 Produkte)
- Synonyme
- BBP antikoerper, D11S636 antikoerper, MBBP antikoerper, ZCCHC25 antikoerper, ZFM1 antikoerper, ZNF162 antikoerper, BB094781 antikoerper, CW17R antikoerper, MZFM antikoerper, WBP4 antikoerper, Zfp162 antikoerper, CG5836 antikoerper, Dmel\\CG5836 antikoerper, cg5836 antikoerper, dSF1 antikoerper, p70 antikoerper, SF1 antikoerper, sf1 antikoerper, wu:fc09f06 antikoerper, znf162 antikoerper, MWD22.25 antikoerper, MWD22_25 antikoerper, SF-1 antikoerper, splicing factor 1 antikoerper, Splicing factor 1 antikoerper, splicing factor-like protein antikoerper, nuclear receptor subfamily 5 group A member 1 antikoerper, splicing factor 1 S homeolog antikoerper, SF1 antikoerper, Sf1 antikoerper, sf1 antikoerper, AT5G51300 antikoerper, NR5A1 antikoerper, sf1.S antikoerper
- Hintergrund
- SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location
-