Splicing Factor 1 Antikörper (N-Term)

Produktnummer ABIN630049

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Splicing Factor 1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Hund.

Kurzübersicht für Splicing Factor 1 Antikörper (N-Term) (ABIN630049)

Target: Splicing Factor 1 (SF1)

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Splicing Factor 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Splicing Factor 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SF1 antibody was raised against the N terminal of SF1

Aufreinigung: Purified

Immunogen: SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF1 Blocking Peptide, (ABIN5616082), is also available for use as a blocking control in assays to test for specificity of this SF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Splicing Factor 1

Target: Splicing Factor 1 (SF1)

Andere Bezeichnung: SF1

Hintergrund: SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location