RG9MTD2 Antikörper
-
- Target Alle RG9MTD2 Antikörper anzeigen
- RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RG9MTD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- RG9 MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
- Top Product
- Discover our top product RG9MTD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RG9MTD2 Blocking Peptide, catalog no. 33R-2317, is also available for use as a blocking control in assays to test for specificity of this RG9MTD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RG9MTD2 (RNA (Guanine-9-) Methyltransferase Domain Containing 2 (RG9MTD2))
- Andere Bezeichnung
- RG9MTD2 (RG9MTD2 Produkte)
- Synonyme
- RG9MTD2 antikoerper, TRM10 antikoerper, Rg9mtd2 antikoerper, 3110023L08Rik antikoerper, AA794508 antikoerper, Rnmtd2 antikoerper, tRNA methyltransferase 10A antikoerper, tRNA methyltransferase 10A L homeolog antikoerper, TRMT10A antikoerper, trmt10a antikoerper, trmt10a.L antikoerper, Trmt10a antikoerper
- Hintergrund
- RG9MTD2 is a probable RNA methyltransferase.
- Molekulargewicht
- 37 kDa (MW of target protein)
-