RPL32 Antikörper (N-Term)

Produktnummer ABIN630044

Der Kaninchen Polyklonal Anti-RPL32-Antikörper wurde für WB validiert. Er ist geeignet, RPL32 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RPL32 Antikörper (N-Term) (ABIN630044)

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL32 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPL32 antibody was raised against the N terminal of RPL32

Aufreinigung: Purified

Immunogen: RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL32 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL32

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Andere Bezeichnung: RPL32

Hintergrund: RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 15 kDa (MW of target protein)