NOVA2 Antikörper (N-Term)

Produktnummer ABIN630042

Dieses Anti-NOVA2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NOVA2 in WB. Geeignet für Human und Zebrafisch (Danio rerio).

Kurzübersicht für NOVA2 Antikörper (N-Term) (ABIN630042)

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Reaktivität: Human, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOVA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOVA2 Antikörper

Bindungsspezifität: N-Term

Spezifität: NOVA2 antibody was raised against the N terminal of NOVA2

Aufreinigung: Purified

Immunogen: NOVA2 antibody was raised using the N terminal of NOVA2 corresponding to a region with amino acids MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOVA2 Blocking Peptide, catalog no. 33R-5942, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOVA2

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Andere Bezeichnung: NOVA2

Hintergrund: NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Molekulargewicht: 54 kDa (MW of target protein)