PCBP2 Antikörper
-
- Target Alle PCBP2 Antikörper anzeigen
- PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE
- Top Product
- Discover our top product PCBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCBP2 Blocking Peptide, catalog no. 33R-4463, is also available for use as a blocking control in assays to test for specificity of this PCBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCBP2 (Poly(rC) Binding Protein 2 (PCBP2))
- Andere Bezeichnung
- PCBP2 (PCBP2 Produkte)
- Synonyme
- HNRNPE2 antikoerper, HNRPE2 antikoerper, hnRNP-E2 antikoerper, AW412548 antikoerper, Hnrpx antikoerper, alphaCP-2 antikoerper, PCBP3 antikoerper, fb36h02 antikoerper, wu:fb36h02 antikoerper, zgc:55964 antikoerper, PCBP2 antikoerper, poly(rC) binding protein 2 antikoerper, poly(rC) binding protein 2 L homeolog antikoerper, PCBP2 antikoerper, Pcbp2 antikoerper, pcbp2 antikoerper, pcbp2.L antikoerper
- Hintergrund
- PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
- Molekulargewicht
- 39 kDa (MW of target protein)
-