HNRNPA3 Antikörper (N-Term)

Produktnummer ABIN630036

Dieses Anti-HNRNPA3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HNRNPA3 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für HNRNPA3 Antikörper (N-Term) (ABIN630036)

Target: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRNPA3 Antikörper

Bindungsspezifität: N-Term

Spezifität: HNRPA3 antibody was raised against the N terminal of HNRPA3

Aufreinigung: Purified

Immunogen: HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPA3 Blocking Peptide, (ABIN5614043), is also available for use as a blocking control in assays to test for specificity of this HNRPA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA3

Target: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Andere Bezeichnung: HNRPA3

Hintergrund: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing

Molekulargewicht: 42 kDa (MW of target protein)