DIS3L2 Antikörper (N-Term)

Produktnummer ABIN630034

Produktdetails anti-DIS3L2 Antikörper

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DIS3L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MGC42174 antibody was raised against the N terminal Of Mgc42174

Aufreinigung: Purified

Immunogen: MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DIS3L2

Target: DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))

Abstract: DIS3L2 Produkte

Synonyme: RGD1560168 antikoerper, DIS3L2 antikoerper, DKFZp469O0522 antikoerper, FAM6A antikoerper, PRLMNS antikoerper, hDIS3L2 antikoerper, 4930429A22Rik antikoerper, 8030493P09Rik antikoerper, DIS3-like 3'-5' exoribonuclease 2 antikoerper, DIS3 like 3'-5' exoribonuclease 2 antikoerper, DIS3-like exonuclease 2 antikoerper, Dis3l2 antikoerper, DIS3L2 antikoerper, LOC100344728 antikoerper

Hintergrund: MGC42174 is a probable exonuclease.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Stem Cell Maintenance