HNRPLL Antikörper (N-Term)

Produktnummer ABIN630031

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HNRPLL in WB und IHC. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für HNRPLL Antikörper (N-Term) (ABIN630031)

Target: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRPLL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRPLL Antikörper

Bindungsspezifität: N-Term

Spezifität: HNRPLL antibody was raised against the N terminal of HNRPLL

Aufreinigung: Purified

Immunogen: HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPLL Blocking Peptide, (ABIN5614051), is also available for use as a blocking control in assays to test for specificity of this HNRPLL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPLL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRPLL

Target: HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))

Andere Bezeichnung: HNRPLL

Hintergrund: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.

Molekulargewicht: 60 kDa (MW of target protein)