RAVER1 Antikörper (N-Term)

Produktnummer ABIN630030

Dieses Anti-RAVER1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RAVER1 in WB und IHC. Geeignet für Human.

Kurzübersicht für RAVER1 Antikörper (N-Term) (ABIN630030)

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAVER1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RAVER1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RAVER1 antibody was raised against the N terminal of RAVER1

Aufreinigung: Purified

Immunogen: RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAVER1 Blocking Peptide, (ABIN5615772), is also available for use as a blocking control in assays to test for specificity of this RAVER1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAVER1

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Andere Bezeichnung: RAVER1

Hintergrund: RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping.

Molekulargewicht: 67 kDa (MW of target protein)