RBM4B Antikörper (C-Term)

Produktnummer ABIN630027

Produktdetails anti-RBM4B Antikörper

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RBM4 B antibody was raised against the C terminal of RBM4

Aufreinigung: Purified

Immunogen: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM4B

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Andere Bezeichnung: RBM4B (RBM4B Produkte)

Synonyme: RBM30 antikoerper, RBM4L antikoerper, ZCCHC15 antikoerper, ZCCHC21B antikoerper, ZCRB3B antikoerper, 4921506I22Rik antikoerper, AI504630 antikoerper, AI506404 antikoerper, Lark2 antikoerper, rbm4 antikoerper, rbm30 antikoerper, rbm4l antikoerper, zcrb3b antikoerper, zcchc15 antikoerper, MGC75893 antikoerper, RBM4B antikoerper, RNA binding motif protein 4B antikoerper, RNA binding motif protein 4B L homeolog antikoerper, RNA-binding protein 4B antikoerper, RBM4B antikoerper, Rbm4b antikoerper, rbm4b antikoerper, rbm4b.L antikoerper, LOC713553 antikoerper, LOC102180196 antikoerper, LOC100058729 antikoerper

Hintergrund: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Photoperiodism