MTHFSD Antikörper (N-Term)

Produktnummer ABIN630026

Der Kaninchen Polyklonal Anti-MTHFSD-Antikörper wurde für WB und IHC validiert. Er ist geeignet, MTHFSD in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für MTHFSD Antikörper (N-Term) (ABIN630026)

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTHFSD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MTHFSD Antikörper

Bindungsspezifität: N-Term

Spezifität: MTHFSD antibody was raised against the N terminal of MTHFSD

Aufreinigung: Purified

Immunogen: MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTHFSD Blocking Peptide, (ABIN938184), is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTHFSD

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Andere Bezeichnung: MTHFSD

Hintergrund: The function remains unknows.

Molekulargewicht: 41 kDa (MW of target protein)