MIF4GD Antikörper (C-Term)

Produktnummer ABIN630025

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MIF4GD in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund und Ratte.

Kurzübersicht für MIF4GD Antikörper (C-Term) (ABIN630025)

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MIF4GD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MIF4GD Antikörper

Bindungsspezifität: C-Term

Spezifität: MIF4 GD antibody was raised against the C terminal of MIF4 D

Aufreinigung: Purified

Immunogen: MIF4 GD antibody was raised using the C terminal of MIF4 D corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MIF4GD Blocking Peptide, catalog no. 33R-4954, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MIF4GD

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Andere Bezeichnung: MIF4GD

Hintergrund: MIF4GD is a protein which contains an MIF4G domain.

Molekulargewicht: 28 kDa (MW of target protein)