LARP7 Antikörper (C-Term)

Produktnummer ABIN630024

Dieses Anti-LARP7-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LARP7 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für LARP7 Antikörper (C-Term) (ABIN630024)

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LARP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LARP7 Antikörper

Bindungsspezifität: C-Term

Spezifität: LARP7 antibody was raised against the C terminal of LARP7

Aufreinigung: Purified

Immunogen: LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LARP7 Blocking Peptide, (ABIN939089), is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LARP7

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Andere Bezeichnung: LARP7

Hintergrund: LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Chromatin Binding, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion