PRP6/ANT-1 Antikörper
Kurzübersicht für PRP6/ANT-1 Antikörper (ABIN630022)
Target
Alle PRP6/ANT-1 (PRPF6) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Purified
-
Immunogen
- PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE
-
-
-
-
Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PRPF6 Blocking Peptide, (ABIN5615582), is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))
-
Andere Bezeichnung
- PRPF6
-
Hintergrund
- PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.
-
Molekulargewicht
- 104 kDa (MW of target protein)
-
Pathways
- Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport
Target
-