PRP6/ANT-1 Antikörper

Produktnummer ABIN630021

Dieses Anti-PRP6/ANT-1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PRP6/ANT-1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PRP6/ANT-1 Antikörper (ABIN630021)

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRP6/ANT-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRP6/ANT-1 Antikörper

Aufreinigung: Purified

Immunogen: PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPF6 Blocking Peptide, (ABIN938516), is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRP6/ANT-1

Target: PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))

Andere Bezeichnung: PRPF6

Hintergrund: PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport