LSM2 Antikörper

Produktnummer ABIN630011

Der Kaninchen-Polyklonal Anti-LSM2-Antikörper wurde für WB und IHC validiert. Er ist geeignet zum Nachweis von LSM2 in Proben aus Human, Maus, Ratte und Hund. }

Kurzübersicht für LSM2 Antikörper (ABIN630011)

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-LSM2 Antikörper

Aufreinigung: Purified

Immunogen: LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM2 Blocking Peptide, (ABIN5614598), is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM2

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Andere Bezeichnung: LSM2

Hintergrund: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 10 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization