PPIE Antikörper

Produktnummer ABIN630007

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PPIE in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio) und Drosophila melanogaster.

Kurzübersicht für PPIE Antikörper (ABIN630007)

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPIE Antikörper

Aufreinigung: Purified

Immunogen: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIE Blocking Peptide, (ABIN5615495), is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIE

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Andere Bezeichnung: PPIE

Hintergrund: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Molekulargewicht: 26 kDa (MW of target protein)