SNRNP70 Antikörper

Produktnummer ABIN630004

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SNRNP70 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Ratte, Maus, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für SNRNP70 Antikörper (ABIN630004)

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Reaktivität: Human, Ratte, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRNP70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SNRNP70 Antikörper

Aufreinigung: Purified

Immunogen: SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRP70 Blocking Peptide, (ABIN936145), is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRNP70

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Andere Bezeichnung: SNRP70

Hintergrund: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Molekulargewicht: 48 kDa (MW of target protein)