RPL8 Antikörper (C-Term)

Produktnummer ABIN629999

Der Kaninchen Polyklonal Anti-RPL8-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RPL8 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RPL8 Antikörper (C-Term) (ABIN629999)

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RPL8 Antikörper

Bindungsspezifität: C-Term

Spezifität: RPL8 antibody was raised against the C terminal of RPL8

Aufreinigung: Purified

Immunogen: RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN

Anwendungsinformationen

Applikationshinweise: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL8 Blocking Peptide, (ABIN937841), is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL8

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Andere Bezeichnung: RPL8

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Regulation of Cell Size