SFRS8 Antikörper (N-Term)

Produktnummer ABIN629997

Dieses Anti-SFRS8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SFRS8 in WB. Geeignet für Human.

Kurzübersicht für SFRS8 Antikörper (N-Term) (ABIN629997)

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFRS8 Antikörper

Bindungsspezifität: N-Term

Spezifität: SFRS8 antibody was raised against the N terminal of SFRS8

Aufreinigung: Purified

Immunogen: SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS8 Blocking Peptide, (ABIN5616106), is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS8

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Andere Bezeichnung: SFRS8

Hintergrund: SFRS8 is a human homolog of Drosophila splicing regulatory protein.

Molekulargewicht: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization