SNRPF Antikörper (N-Term)

Produktnummer ABIN629996

Der Kaninchen Polyklonal Anti-SNRPF-Antikörper wurde für WB und IHC validiert. Er ist geeignet, SNRPF in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für SNRPF Antikörper (N-Term) (ABIN629996)

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SNRPF Antikörper

Bindungsspezifität: N-Term

Spezifität: SNRPF antibody was raised against the N terminal of SNRPF

Aufreinigung: Purified

Immunogen: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Anwendungsinformationen

Applikationshinweise: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPF Blocking Peptide, (ABIN5616328), is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPF

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Andere Bezeichnung: SNRPF

Hintergrund: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization