SFPQ Antikörper

Produktnummer ABIN629995

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SFPQ in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SFPQ Antikörper (ABIN629995)

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFPQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SFPQ Antikörper

Aufreinigung: Purified

Immunogen: SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFPQ Blocking Peptide, (ABIN5616098), is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFPQ

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Andere Bezeichnung: SFPQ

Hintergrund: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.

Molekulargewicht: 78 kDa (MW of target protein)