OLA1 Antikörper

Produktnummer ABIN629990

Der Kaninchen Polyklonal Anti-OLA1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, OLA1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für OLA1 Antikörper (ABIN629990)

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-OLA1 Antikörper

Aufreinigung: Purified

Immunogen: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP9 Blocking Peptide, (ABIN5613905), is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLA1

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Andere Bezeichnung: GTPBP9

Hintergrund: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Molekulargewicht: 44 kDa (MW of target protein)