NIP7 Antikörper

Produktnummer ABIN629985

Dieser Anti-NIP7 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von NIP7 in WB und IHC. Geeignet für Human, Maus und Hund.

Kurzübersicht für NIP7 Antikörper (ABIN629985)

Target: NIP7 (Nuclear Import 7 Homolog (NIP7))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NIP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NIP7 Antikörper

Aufreinigung: Purified

Immunogen: NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NIP7 Blocking Peptide, (ABIN5614996), is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NIP7

Target: NIP7 (Nuclear Import 7 Homolog (NIP7))

Andere Bezeichnung: NIP7

Hintergrund: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly