KLHDC8A Antikörper (C-Term)

Produktnummer ABIN629982

Dieses Anti-KLHDC8A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KLHDC8A in WB. Geeignet für Human.

Kurzübersicht für KLHDC8A Antikörper (C-Term) (ABIN629982)

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC8A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHDC8A Antikörper

Bindungsspezifität: C-Term

Spezifität: KLHDC8 A antibody was raised against the C terminal of KLHDC8

Aufreinigung: Purified

Immunogen: KLHDC8 A antibody was raised using the C terminal of KLHDC8 corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC8A Blocking Peptide, (ABIN5614374), is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC8A

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Andere Bezeichnung: KLHDC8A

Hintergrund: The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)