KLHDC8A Antikörper (C-Term)
-
- Target Alle KLHDC8A Antikörper anzeigen
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHDC8A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLHDC8 A antibody was raised against the C terminal of KLHDC8
- Aufreinigung
- Purified
- Immunogen
- KLHDC8 A antibody was raised using the C terminal of KLHDC8 corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
- Top Product
- Discover our top product KLHDC8A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHDC8A Blocking Peptide, catalog no. 33R-7110, is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
- Andere Bezeichnung
- KLHDC8A (KLHDC8A Produkte)
- Hintergrund
- The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 39 kDa (MW of target protein)
-