SRP14 Antikörper

Produktnummer ABIN629979

Dieses Anti-SRP14-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SRP14 in WB und IHC. Geeignet für Human und Hund.

Kurzübersicht für SRP14 Antikörper (ABIN629979)

Target: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRP14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SRP14 Antikörper

Aufreinigung: Purified

Immunogen: SRP14 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRP14 Blocking Peptide, (ABIN939973), is also available for use as a blocking control in assays to test for specificity of this SRP14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRP14

Target: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Andere Bezeichnung: SRP14

Hintergrund: SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

Molekulargewicht: 15 kDa (MW of target protein)