DDX6 Antikörper

Produktnummer ABIN629973

Produktdetails anti-DDX6 Antikörper

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX6 Blocking Peptide, catalog no. 33R-4684, is also available for use as a blocking control in assays to test for specificity of this DDX6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX6

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Andere Bezeichnung: DDX6 (DDX6 Produkte)

Synonyme: si:ch211-147p17.1 antikoerper, P54H antikoerper, Xp54 antikoerper, hlr2 antikoerper, me31b antikoerper, p54 antikoerper, rck antikoerper, HLR2 antikoerper, P54 antikoerper, RCK antikoerper, p54h antikoerper, RGD1564560 antikoerper, 1110001P04Rik antikoerper, E230023J21Rik antikoerper, mRCK/P54 antikoerper, DEAD-box helicase 6 antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 6 antikoerper, DEAD-box helicase 6 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 antikoerper, DDX6 antikoerper, ddx6 antikoerper, ddx6.L antikoerper, Ddx6 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX6 encodes a DEAD box protein. It may contribute to the cell proliferation and carcinogenesis.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization