DDX1 Antikörper

Produktnummer ABIN629970

Dieses Anti-DDX1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DDX1 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für DDX1 Antikörper (ABIN629970)

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX1 Antikörper

Aufreinigung: Purified

Immunogen: DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX1 Blocking Peptide, (ABIN5613154), is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX1

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Andere Bezeichnung: DDX1

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization