CELF2 Antikörper (N-Term)

Produktnummer ABIN629968

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch CELF2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund.

Kurzübersicht für CELF2 Antikörper (N-Term) (ABIN629968)

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CELF2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CUGBP2 antibody was raised against the N terminal of CUGBP2

Aufreinigung: Purified

Immunogen: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUGBP2 Blocking Peptide, (ABIN5613034), is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF2

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Andere Bezeichnung: CUGBP2

Hintergrund: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization