RPS14 Antikörper (N-Term)
-
- Target Alle RPS14 Antikörper anzeigen
- RPS14 (Ribosomal Protein S14 (RPS14))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS14 antibody was raised against the N terminal of RPS14
- Aufreinigung
- Purified
- Immunogen
- RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE
- Top Product
- Discover our top product RPS14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS14 (Ribosomal Protein S14 (RPS14))
- Andere Bezeichnung
- RPS14 (RPS14 Produkte)
- Synonyme
- EMTB antikoerper, S14 antikoerper, 2600014J02Rik antikoerper, AL023078 antikoerper, fa92e08 antikoerper, wu:fa92e08 antikoerper, zgc:73215 antikoerper, CG1527 antikoerper, Dmel\CG1527 antikoerper, RPS14B antikoerper, RpS14 antikoerper, RpS14B antikoerper, S14b antikoerper, anon-EST:Posey115 antikoerper, anon-EST:Posey131 antikoerper, anon-EST:Posey154 antikoerper, anon-EST:Posey77 antikoerper, rpS14B antikoerper, ribosomal protein S14 antikoerper, 40S ribosomal protein S14 antikoerper, ribosomal protein S14 L homeolog antikoerper, 30S ribosomal protein S14 antikoerper, Ribosomal protein S14b antikoerper, mitochondrial ribosomal protein S14 antikoerper, RPS14 antikoerper, Rps14 antikoerper, rps-14 antikoerper, rps14 antikoerper, rps14.L antikoerper, LOC100286294 antikoerper, RpS14 antikoerper, RpS14b antikoerper, MRPS14 antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-